Lineage for d3l4mc_ (3l4m C:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462380Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1462381Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1462382Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1462403Protein automated matches [190303] (2 species)
    not a true protein
  7. 1462434Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1462453Domain d3l4mc_: 3l4m C: [179938]
    Other proteins in same PDB: d3l4md_, d3l4mf_
    automated match to d1mg2b_
    complexed with 1pe, act, ca, hec, pg4

Details for d3l4mc_

PDB Entry: 3l4m (more details), 2.02 Å

PDB Description: crystal structure of the maug/pre-methylamine dehydrogenase complex.
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3l4mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4mc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3l4mc_:

Click to download the PDB-style file with coordinates for d3l4mc_.
(The format of our PDB-style files is described here.)

Timeline for d3l4mc_: