Lineage for d3l4dc_ (3l4d C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278112Species Leishmania infantum [TaxId:5671] [189170] (1 PDB entry)
  8. 1278115Domain d3l4dc_: 3l4d C: [179934]
    automated match to d1x8va_
    complexed with hem, n8e, tpf

Details for d3l4dc_

PDB Entry: 3l4d (more details), 2.75 Å

PDB Description: Crystal structure of sterol 14-alpha demethylase (CYP51) from Leishmania infantum in complex with fluconazole
PDB Compounds: (C:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d3l4dc_:

Sequence, based on SEQRES records: (download)

>d3l4dc_ a.104.1.0 (C:) automated matches {Leishmania infantum [TaxId: 5671]}
gklppvvhgttpfvghiiqfgkdplgfmlkakkkyggiftmnicgnritvvgdvhqhskf
ftprneilsprevysfmvpvfgegvayaapyprmreqlnflaeeltvakfqnfapsiqhe
vrkfmkanwnkdegeinilddcsamiintacqclfgedlrkrldarqfaqllakmescli
paavflpwilklplpqsyrcrdaraelqdilseiiiarekeeaqkdtntsdllagllgav
yrdgtrmsqhevcgmivaamfagqhtstitttwsllhlmdprnkrhlaklhqeidefpaq
lnydnvmeempfaeqcaresirrdpplvmlmrkvlkpvqvgkyvvpegdiiacspllshq
deeafpnprewnpernmklvdgafcgfgagvhkcigekfgllqvktvlatvlrdydfell
gplpepnyhtmvvgptasqcrvkyikkk

Sequence, based on observed residues (ATOM records): (download)

>d3l4dc_ a.104.1.0 (C:) automated matches {Leishmania infantum [TaxId: 5671]}
gklppvvhgttpfvghiiqfgkdplgfmlkakkkyggiftmnicgnritvvgdvhqhskf
ftprneilsprevysfmvpvfgegvayaapyprmreqlnflaeeltvakfqnfapsiqhe
vrkfmkanwnkdegeinilddcsamiintacqclfgedlrkrldarqfaqllakmescli
paavflpwilklplpqsyrcrdaraelqdilseiiiarekeeaqkdttsdllagllgavy
rdgtrmsqhevcgmivaamfagqhtstitttwsllhlmdprnkrhlaklhqeidefpaql
nydnvmeempfaeqcaresirrdpplvmlmrkvlkpvqvgkyvvpegdiiacspllshqd
eeafpnprewnpernmklvdgafcgfgagvhkcigekfgllqvktvlatvlrdydfellg
plpepnyhtmvvgptasqcrvkyikkk

SCOPe Domain Coordinates for d3l4dc_:

Click to download the PDB-style file with coordinates for d3l4dc_.
(The format of our PDB-style files is described here.)

Timeline for d3l4dc_: