Lineage for d3l4db_ (3l4d B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1744326Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1744327Protein automated matches [190847] (45 species)
    not a true protein
  7. 1744474Species Leishmania infantum [TaxId:5671] [189170] (1 PDB entry)
  8. 1744476Domain d3l4db_: 3l4d B: [179933]
    automated match to d1x8va_
    complexed with hem, n8e, tpf

Details for d3l4db_

PDB Entry: 3l4d (more details), 2.75 Å

PDB Description: Crystal structure of sterol 14-alpha demethylase (CYP51) from Leishmania infantum in complex with fluconazole
PDB Compounds: (B:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d3l4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4db_ a.104.1.0 (B:) automated matches {Leishmania infantum [TaxId: 5671]}
kgklppvvhgttpfvghiiqfgkdplgfmlkakkkyggiftmnicgnritvvgdvhqhsk
fftprneilsprevysfmvpvfgegvayaapyprmreqlnflaeeltvakfqnfapsiqh
evrkfmkanwnkdegeinilddcsamiintacqclfgedlrkrldarqfaqllakmescl
ipaavflpwilklplpqsyrcrdaraelqdilseiiiarekeeaqkdtntsdllagllga
vyrdgtrmsqhevcgmivaamfagqhtstitttwsllhlmdprnkrhlaklhqeidefpa
qlnydnvmeempfaeqcaresirrdpplvmlmrkvlkpvqvgkyvvpegdiiacspllsh
qdeeafpnprewnpernmklvdgafcgfgagvhkcigekfgllqvktvlatvlrdydfel
lgplpepnyhtmvvgptasqcrvkyikkk

SCOPe Domain Coordinates for d3l4db_:

Click to download the PDB-style file with coordinates for d3l4db_.
(The format of our PDB-style files is described here.)

Timeline for d3l4db_: