Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (33 species) not a true protein |
Species Leishmania infantum [TaxId:5671] [189170] (1 PDB entry) |
Domain d3l4da_: 3l4d A: [179932] automated match to d1x8va_ complexed with hem, n8e, tpf |
PDB Entry: 3l4d (more details), 2.75 Å
SCOPe Domain Sequences for d3l4da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4da_ a.104.1.0 (A:) automated matches {Leishmania infantum [TaxId: 5671]} gklppvvhgttpfvghiiqfgkdplgfmlkakkkyggiftmnicgnritvvgdvhqhskf ftprneilsprevysfmvpvfgegvayaapyprmreqlnflaeeltvakfqnfapsiqhe vrkfmkanwnkdegeinilddcsamiintacqclfgedlrkrldarqfaqllakmescli paavflpwilklplpqsyrcrdaraelqdilseiiiarekeeaqkdtntsdllagllgav yrdgtrmsqhevcgmivaamfagqhtstitttwsllhlmdprnkrhlaklhqeidefpaq lnydnvmeempfaeqcaresirrdpplvmlmrkvlkpvqvgkyvvpegdiiacspllshq deeafpnprewnpernmklvdgafcgfgagvhkcigekfgllqvktvlatvlrdydfell gplpepnyhtmvvgptasqcrvkyikkk
Timeline for d3l4da_: