Lineage for d3l44b_ (3l44 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132305Species Bacillus anthracis [TaxId:261594] [189194] (4 PDB entries)
  8. 2132311Domain d3l44b_: 3l44 B: [179930]
    automated match to d2gsaa_

Details for d3l44b_

PDB Entry: 3l44 (more details), 2.05 Å

PDB Description: crystal structure of bacillus anthracis heml-1, glutamate semialdehyde aminotransferase
PDB Compounds: (B:) Glutamate-1-semialdehyde 2,1-aminomutase 1

SCOPe Domain Sequences for d3l44b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l44b_ c.67.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
vvkftksealhkealehivggvnspsrsfkavgggapiamergkgayfwdvdgnkyidyl
aaygpiitghahphitkaittaaengvlygtptalevkfakmlkeampaldkvrfvnsgt
eavmttirvaraytgrtkimkfagcyhghsdlvlvaagsgpstlgtpdsagvpqsiaqev
itvpfnnvetlkealdkwghevaailvepivgnfgivepkpgflekvnelvheagalviy
devitafrfmyggaqdllgvtpdltalgkviggglpigayggkkeimeqvaplgpayqag
tmagnpasmasgiaclevlqqeglyekldelgatlekgileqaakhniditlnrlkgalt
vyfttntiedydaaqdtdgemfgkffklmlqegvnlapskyeawflttehtkedieytie
avgrafaaladnk

SCOPe Domain Coordinates for d3l44b_:

Click to download the PDB-style file with coordinates for d3l44b_.
(The format of our PDB-style files is described here.)

Timeline for d3l44b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3l44a_