Lineage for d3l3za1 (3l3z A:670-918)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008479Protein Androgen receptor [63621] (4 species)
  7. 2008489Species Human (Homo sapiens) [TaxId:9606] [63623] (62 PDB entries)
    Uniprot P10275 671-919
  8. 2008549Domain d3l3za1: 3l3z A:670-918 [179924]
    Other proteins in same PDB: d3l3za2
    automated match to d1e3ga_
    complexed with dht

Details for d3l3za1

PDB Entry: 3l3z (more details)

PDB Description: crystal structure of dht-bound androgen receptor in complex with the third motif of steroid receptor coactivator 3
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d3l3za1:

Sequence, based on SEQRES records: (download)

>d3l3za1 a.123.1.1 (A:670-918) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

Sequence, based on observed residues (ATOM records): (download)

>d3l3za1 a.123.1.1 (A:670-918) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfht

SCOPe Domain Coordinates for d3l3za1:

Click to download the PDB-style file with coordinates for d3l3za1.
(The format of our PDB-style files is described here.)

Timeline for d3l3za1: