Lineage for d3l3xa1 (3l3x A:670-918)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728297Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2728312Domain d3l3xa1: 3l3x A:670-918 [179923]
    Other proteins in same PDB: d3l3xa2
    automated match to d1e3ga_
    complexed with dht

Details for d3l3xa1

PDB Entry: 3l3x (more details), 1.55 Å

PDB Description: crystal structure of dht-bound androgen receptor in complex with the first motif of steroid receptor coactivator 3
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d3l3xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l3xa1 a.123.1.1 (A:670-918) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

SCOPe Domain Coordinates for d3l3xa1:

Click to download the PDB-style file with coordinates for d3l3xa1.
(The format of our PDB-style files is described here.)

Timeline for d3l3xa1: