Lineage for d3l3na_ (3l3n A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034571Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 1034583Protein Angiotensin converting enzyme, ACE [82733] (2 species)
    M2 family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 1034591Species Human (Homo sapiens) [TaxId:9606] [82734] (9 PDB entries)
    Uniprot P22966
  8. 1034600Domain d3l3na_: 3l3n A: [179912]
    automated match to d1o86a_
    complexed with cl, lsw, zn

Details for d3l3na_

PDB Entry: 3l3n (more details), 2.3 Å

PDB Description: testis ace co-crystal structure with novel inhibitor lisw
PDB Compounds: (A:) angiotensin-converting enzyme

SCOPe Domain Sequences for d3l3na_:

Sequence, based on SEQRES records: (download)

>d3l3na_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip
fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp
yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq
litgqpqmsasamlsyfkplldwlrtenelhgeklgwp

Sequence, based on observed residues (ATOM records): (download)

>d3l3na_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllsssdehdinflmkmaldkiafipfsy
lvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpyir
yfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlit
gqpqmsasamlsyfkplldwlrtenelhgeklgwp

SCOPe Domain Coordinates for d3l3na_:

Click to download the PDB-style file with coordinates for d3l3na_.
(The format of our PDB-style files is described here.)

Timeline for d3l3na_: