Lineage for d3l3hb_ (3l3h B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746679Domain d3l3hb_: 3l3h B: [179908]
    automated match to d1biib_
    mutant

Details for d3l3hb_

PDB Entry: 3l3h (more details), 2.7 Å

PDB Description: x-ray crystal structure of the f6a mutant of influenza a acid polymerase epitope pa224 bound to murine h2-db mhc
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3l3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l3hb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3l3hb_:

Click to download the PDB-style file with coordinates for d3l3hb_.
(The format of our PDB-style files is described here.)

Timeline for d3l3hb_: