![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
![]() | Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
![]() | Protein automated matches [190046] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries) |
![]() | Domain d3l33h_: 3l33 H: [179899] Other proteins in same PDB: d3l33a_, d3l33b_, d3l33c_, d3l33d_ automated match to d1aapa_ complexed with ca, fmt |
PDB Entry: 3l33 (more details), 2.48 Å
SCOPe Domain Sequences for d3l33h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l33h_ g.8.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc
Timeline for d3l33h_: