SCOPe 2.08: Domain d3l33f_: 3l33 F:

Lineage for d3l33f_ (3l33 F:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)

8. Domain d3l33f_: 3l33 F: [179897]
   Other proteins in same PDB: d3l33a_, d3l33b_, d3l33c_, d3l33d_
   automated match to d1aapa_
   complexed with ca, fmt

Details for d3l33f_

PDB Entry: 3l33, 2.48 Å

PDB Description: Human mesotrypsin complexed with amyloid precursor protein inhibitor(APPI)

PDB Compounds: (F:) amyloid beta a4 protein

SCOPe Domain Sequences for d3l33f_:

Sequence; same for both SEQRES and ATOM records:

>d3l33f_ g.8.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc

Timeline for d3l33f_:

• d3l33f_ first appeared in SCOPe 2.01
  
• d3l33f_ appears in SCOPe 2.07