Lineage for d3l33f_ (3l33 F:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2583930Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 protein domains)
  6. 2584120Protein automated matches [190046] (3 species)
    not a true protein
  7. 2584151Species Human (Homo sapiens) [TaxId:9606] [186911] (7 PDB entries)
  8. 2584160Domain d3l33f_: 3l33 F: [179897]
    Other proteins in same PDB: d3l33a_, d3l33b_, d3l33c_, d3l33d_
    automated match to d1aapa_
    complexed with ca, fmt

Details for d3l33f_

PDB Entry: 3l33 (more details), 2.48 Å

PDB Description: Human mesotrypsin complexed with amyloid precursor protein inhibitor(APPI)
PDB Compounds: (F:) amyloid beta a4 protein

SCOPe Domain Sequences for d3l33f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l33f_ g.8.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavc

SCOPe Domain Coordinates for d3l33f_:

Click to download the PDB-style file with coordinates for d3l33f_.
(The format of our PDB-style files is described here.)

Timeline for d3l33f_: