Lineage for d3l30a_ (3l30 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346343Protein automated matches [190139] (27 species)
    not a true protein
  7. 2346507Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries)
  8. 2346508Domain d3l30a_: 3l30 A: [179891]
    automated match to d1hn4a_
    complexed with ca, cl, dbw

Details for d3l30a_

PDB Entry: 3l30 (more details), 2.4 Å

PDB Description: Crystal structure of porcine pancreatic phospholipase A2 complexed with dihydroxyberberine
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d3l30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l30a_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d3l30a_:

Click to download the PDB-style file with coordinates for d3l30a_.
(The format of our PDB-style files is described here.)

Timeline for d3l30a_: