![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) automatically mapped to Pfam PF00354 |
![]() | Protein C-reactive protein (CRP) [49954] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries) |
![]() | Domain d3l2yr_: 3l2y R: [179888] automated match to d1b09a_ complexed with ca, ope |
PDB Entry: 3l2y (more details), 2.7 Å
SCOPe Domain Sequences for d3l2yr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2yr_ b.29.1.5 (R:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf spnvlnwralkyevqgevftkpqlwp
Timeline for d3l2yr_: