SCOPe 2.05: Domain d7icea1: 7ice A:9-91

Lineage for d7icea1 (7ice A:9-91)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (144 PDB entries)
   Uniprot P06746

8. Domain d7icea1: 7ice A:9-91 [17987]
   Other proteins in same PDB: d7icea3, d7icea4
   protein/DNA complex; complexed with na

Details for d7icea1

PDB Entry: 7ice, 2.8 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of cacl2

PDB Compounds: (A:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d7icea1:

Sequence; same for both SEQRES and ATOM records:

>d7icea1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d7icea1:

• d7icea1 first appeared (with stable ids) in SCOP 1.55
  
• d7icea1 appears in SCOPe 2.04
  
• d7icea1 appears in SCOPe 2.06
  
• d7icea1 appears in the current release, SCOPe 2.08