Lineage for d3l2ca_ (3l2c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693303Protein Afx (Foxo4) [46833] (1 species)
  7. 2693304Species Human (Homo sapiens) [TaxId:9606] [46834] (2 PDB entries)
  8. 2693305Domain d3l2ca_: 3l2c A: [179869]
    automatically matched to d1e17a_
    protein/DNA complex; complexed with mg

Details for d3l2ca_

PDB Entry: 3l2c (more details), 1.87 Å

PDB Description: Crystal Structure of the DNA Binding Domain of FOXO4 Bound to DNA
PDB Compounds: (A:) Forkhead box protein O4

SCOPe Domain Sequences for d3l2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2ca_ a.4.5.14 (A:) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]}
rrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpyfkdkgdsnssagwknsirh
nlslhskfikvhneatgksswwmln

SCOPe Domain Coordinates for d3l2ca_:

Click to download the PDB-style file with coordinates for d3l2ca_.
(The format of our PDB-style files is described here.)

Timeline for d3l2ca_: