SCOPe 2.08: Domain d3l21f_: 3l21 F:

Lineage for d3l21f_ (3l21 F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189568] (1 PDB entry)

8. Domain d3l21f_: 3l21 F: [179868]
   automated match to d1xxxa1
   complexed with act, bme, cl, gol, pyr, so4; mutant

Details for d3l21f_

PDB Entry: 3l21, 2.1 Å

PDB Description: the crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r

PDB Compounds: (F:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3l21f_:

Sequence; same for both SEQRES and ATOM records:

>d3l21f_ c.1.10.1 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
fdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdge
kiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrgl
qahftavadatelpmllydipgrsavpiepdtiralashpnivgvxdakadlhsgaqima
dtglayysgddalnlpwlrmgatgfisviahlaagqlrellsafgsgdiatarkiniava
plcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr

Timeline for d3l21f_:

• d3l21f_ first appeared in SCOPe 2.01
  
• d3l21f_ appears in SCOPe 2.07