Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (14 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189568] (1 PDB entry) |
Domain d3l21a_: 3l21 A: [179863] automated match to d1xxxa1 complexed with act, bme, cl, gol, pyr, so4; mutant |
PDB Entry: 3l21 (more details), 2.1 Å
SCOPe Domain Sequences for d3l21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l21a_ c.1.10.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vgfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttd gekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqr glqahftavadatelpmllydipgrsavpiepdtiralashpnivgvxdakadlhsgaqi madtglayysgddalnlpwlrmgatgfisviahlaagqlrellsafgsgdiatarkinia vaplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr
Timeline for d3l21a_: