Lineage for d3l1td_ (3l1t D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925971Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 925972Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 926080Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 926174Protein automated matches [190276] (5 species)
    not a true protein
  7. 926188Species Escherichia coli K-12 [TaxId:83333] [189512] (1 PDB entry)
  8. 926192Domain d3l1td_: 3l1t D: [179861]
    automated match to d1gu6a_
    complexed with ca, edo, hec, so3

Details for d3l1td_

PDB Entry: 3l1t (more details), 2.3 Å

PDB Description: E. coli NrfA sulfite ocmplex
PDB Compounds: (D:) Cytochrome c-552

SCOPe Domain Sequences for d3l1td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l1td_ a.138.1.3 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

SCOPe Domain Coordinates for d3l1td_:

Click to download the PDB-style file with coordinates for d3l1td_.
(The format of our PDB-style files is described here.)

Timeline for d3l1td_: