SCOPe 2.04: Domain d3l1ta_: 3l1t A:

Lineage for d3l1ta_ (3l1t A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189512] (1 PDB entry)

8. Domain d3l1ta_: 3l1t A: [179858]
   automated match to d1gu6a_
   complexed with ca, edo, hec, so3

Details for d3l1ta_

PDB Entry: 3l1t, 2.3 Å

PDB Description: E. coli NrfA sulfite ocmplex

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3l1ta_:

Sequence; same for both SEQRES and ATOM records:

>d3l1ta_ a.138.1.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

Timeline for d3l1ta_:

• d3l1ta_ first appeared in SCOPe 2.01
  
• d3l1ta_ appears in SCOPe 2.03
  
• d3l1ta_ appears in SCOPe 2.05
  
• d3l1ta_ appears in the current release, SCOPe 2.08