Lineage for d3l1cb1 (3l1c B:293-674)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111634Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
    contains coiled-coil neck
  7. 2111642Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [52650] (4 PDB entries)
  8. 2111647Domain d3l1cb1: 3l1c B:293-674 [179855]
    Other proteins in same PDB: d3l1ca2, d3l1cb2
    automated match to d1n6ma_
    complexed with adp, mg; mutant

Details for d3l1cb1

PDB Entry: 3l1c (more details), 2.75 Å

PDB Description: Kinesin-14 Protein Ncd, T436S Mutant
PDB Compounds: (B:) Kinesin-14 Ncd

SCOPe Domain Sequences for d3l1cb1:

Sequence, based on SEQRES records: (download)

>d3l1cb1 c.37.1.9 (B:293-674) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
haalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvf
crirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdif
emvspliqsaldgynicifaygqsgsgktytmdgvpesvgviprtvdllfdsirgyrnlg
weyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlm
htakmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstr
mtetkninrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqd
cfqesvkslrfaasvnsckmtk

Sequence, based on observed residues (ATOM records): (download)

>d3l1cb1 c.37.1.9 (B:293-674) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
haalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvf
crirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdif
emvspliqsaldgynicifaygqsgsgktytmdgvpesvgviprtvdllfdsirweyeik
atfleiynevlydllsiteetvldpnhlrhlmhtakmnrrssrshavtkleligrhaeis
vgsinlvdlagsespnrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmf
invspfqdcfqesvkslrfaasvnsckmtk

SCOPe Domain Coordinates for d3l1cb1:

Click to download the PDB-style file with coordinates for d3l1cb1.
(The format of our PDB-style files is described here.)

Timeline for d3l1cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l1cb2