Lineage for d3l18b_ (3l18 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840499Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 1840615Protein automated matches [190995] (5 species)
    not a true protein
  7. 1840625Species Thermococcus onnurineus [TaxId:523850] [189567] (1 PDB entry)
  8. 1840627Domain d3l18b_: 3l18 B: [179852]
    automated match to d1g2ia_

Details for d3l18b_

PDB Entry: 3l18 (more details), 1.78 Å

PDB Description: Ton1285, an Intracellular Protease from Thermococcus onnurineus NA1
PDB Compounds: (B:) Intracellular protease I

SCOPe Domain Sequences for d3l18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l18b_ c.23.16.2 (B:) automated matches {Thermococcus onnurineus [TaxId: 523850]}
smkvlflsadgfedleliyplhrikeeghevyvasfqrgkitgkhgysvnvdltfeevdp
defdalvlpggkapeivrlnekavmitrrmfeddkpvasichgpqilisakvlkgrrgts
titirddvinagaewidaevvvdgnwvssrhpgdlyawmrefvkllh

SCOPe Domain Coordinates for d3l18b_:

Click to download the PDB-style file with coordinates for d3l18b_.
(The format of our PDB-style files is described here.)

Timeline for d3l18b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3l18a_