SCOPe 2.04: Domain d3l18b_: 3l18 B:

Lineage for d3l18b_ (3l18 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein automated matches [190995] (5 species)
   not a true protein

7. Species Thermococcus onnurineus [TaxId:523850] [189567] (1 PDB entry)

8. Domain d3l18b_: 3l18 B: [179852]
   automated match to d1g2ia_

Details for d3l18b_

PDB Entry: 3l18, 1.78 Å

PDB Description: Ton1285, an Intracellular Protease from Thermococcus onnurineus NA1

PDB Compounds: (B:) Intracellular protease I

SCOPe Domain Sequences for d3l18b_:

Sequence; same for both SEQRES and ATOM records:

>d3l18b_ c.23.16.2 (B:) automated matches {Thermococcus onnurineus [TaxId: 523850]}
smkvlflsadgfedleliyplhrikeeghevyvasfqrgkitgkhgysvnvdltfeevdp
defdalvlpggkapeivrlnekavmitrrmfeddkpvasichgpqilisakvlkgrrgts
titirddvinagaewidaevvvdgnwvssrhpgdlyawmrefvkllh

Timeline for d3l18b_:

• d3l18b_ first appeared in SCOPe 2.01
  
• d3l18b_ appears in SCOPe 2.03
  
• d3l18b_ appears in SCOPe 2.05
  
• d3l18b_ appears in the current release, SCOPe 2.08, called d3l18b1