Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins) Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet; |
Protein automated matches [190659] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries) |
Domain d3l0bb_: 3l0b B: [179836] automated match to d1ta0a_ complexed with 1pg, mg; mutant |
PDB Entry: 3l0b (more details), 2.35 Å
SCOPe Domain Sequences for d3l0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l0bb_ c.108.1.16 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphvd eflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlg rdlrrvlilanspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlrq
Timeline for d3l0bb_: