SCOPe 2.08: Domain d3l0bb_: 3l0b B:

Lineage for d3l0bb_ (3l0b B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
   Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;

6. Protein automated matches [190659] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries)

8. Domain d3l0bb_: 3l0b B: [179836]
   automated match to d1ta0a_
   complexed with 1pg, mg; mutant

Details for d3l0bb_

PDB Entry: 3l0b, 2.35 Å

PDB Description: crystal structure of scp1 phosphatase d206a mutant phosphoryl- intermediate

PDB Compounds: (B:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

SCOPe Domain Sequences for d3l0bb_:

Sequence; same for both SEQRES and ATOM records:

>d3l0bb_ c.108.1.16 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphvd
eflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlg
rdlrrvlilanspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlrq

Timeline for d3l0bb_:

• d3l0bb_ first appeared in SCOPe 2.01
  
• d3l0bb_ appears in SCOPe 2.07