SCOPe 2.05: Domain d3kzld_: 3kzl D:

Lineage for d3kzld_ (3kzl D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.0: automated matches [191555] (1 protein)
   not a true family

6. Protein automated matches [190957] (3 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries)

8. Domain d3kzld_: 3kzl D: [179832]
   automated match to d2nyga1
   complexed with aco, cl, epe, mg; mutant

Details for d3kzld_

PDB Entry: 3kzl, 2.1 Å

PDB Description: crystal structure of ba2930 mutant (h183g) in complex with accoa

PDB Compounds: (D:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3kzld_:

Sequence; same for both SEQRES and ATOM records:

>d3kzld_ c.140.1.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
sntsvglsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
gkignakcrlmkqrdivdfgtewfrk

Timeline for d3kzld_:

• d3kzld_ first appeared in SCOPe 2.01
  
• d3kzld_ appears in SCOPe 2.04
  
• d3kzld_ is called d3kzld1 in SCOPe 2.06
  
• d3kzld_ appears in the current release, SCOPe 2.08, called d3kzld1