Lineage for d3kzgd_ (3kzg D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915657Species Legionella pneumophila [TaxId:272624] [189169] (1 PDB entry)
  8. 2915661Domain d3kzgd_: 3kzg D: [179831]
    automated match to d1hpbp_

Details for d3kzgd_

PDB Entry: 3kzg (more details), 2.06 Å

PDB Description: crystal structure of an arginine 3rd transport system periplasmic binding protein from legionella pneumophila
PDB Compounds: (D:) Arginine 3rd transport system periplasmic binding protein

SCOPe Domain Sequences for d3kzgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kzgd_ c.94.1.0 (D:) automated matches {Legionella pneumophila [TaxId: 272624]}
slnltigtskfnppfevwsgnnsslygfdidlmqeicrrlhatctfeayifddlfpalkn
revdlviasmiitderkkhfifslpymesnsqyittvdskistfddlhgkkigvrkgtpy
arqvlsenrnnqvifyeliqdmllglsnnqvdaslmdyeaakywmasepyaykligkkyk
ligkkisigegysimanpdqfvlikkinkillemeadgtylrlyseyf

SCOPe Domain Coordinates for d3kzgd_:

Click to download the PDB-style file with coordinates for d3kzgd_.
(The format of our PDB-style files is described here.)

Timeline for d3kzgd_: