| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries) |
| Domain d8icoa1: 8ico A:9-91 [17983] Other proteins in same PDB: d8icoa3, d8icoa4 protein/DNA complex; complexed with azt, mn, na |
PDB Entry: 8ico (more details), 2.7 Å
SCOP Domain Sequences for d8icoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icoa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd
Timeline for d8icoa1: