Lineage for d3kz8b_ (3kz8 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034243Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2034244Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 protein domains)
  6. 2034245Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2034246Species Human (Homo sapiens) [TaxId:9606] [49420] (40 PDB entries)
  8. 2034289Domain d3kz8b_: 3kz8 B: [179825]
    automated match to d1gzha_
    protein/DNA complex; complexed with iod, zn

Details for d3kz8b_

PDB Entry: 3kz8 (more details), 1.91 Å

PDB Description: Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs (p53-DNA complex 3)
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3kz8b_:

Sequence, based on SEQRES records: (download)

>d3kz8b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
cacpgrdrrteeenlrkk

Sequence, based on observed residues (ATOM records): (download)

>d3kz8b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdlappqhlirvegnlrveylddrntfrhsvv
vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcac
pgrdrrteeenlrkk

SCOPe Domain Coordinates for d3kz8b_:

Click to download the PDB-style file with coordinates for d3kz8b_.
(The format of our PDB-style files is described here.)

Timeline for d3kz8b_: