Lineage for d3kz7a_ (3kz7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548640Protein automated matches [191209] (6 species)
    not a true protein
  7. 2548717Species Mouse (Mus musculus) [TaxId:10090] [189566] (1 PDB entry)
  8. 2548718Domain d3kz7a_: 3kz7 A: [179823]
    automated match to d1pbka_
    complexed with rap

Details for d3kz7a_

PDB Entry: 3kz7 (more details), 1.95 Å

PDB Description: C-terminal domain of Murine FKBP25 rapamycin complex
PDB Compounds: (A:) FK506-binding protein 3

SCOPe Domain Sequences for d3kz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kz7a_ d.26.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
egppkytksilkkgdktnfpkkgdvvhcwytgtlpdgtvfdtniqtsskkkknakplsfk
vgvgkvirgwdealltmskgekarleiepewaygkkgqpdakippntklifevelvdid

SCOPe Domain Coordinates for d3kz7a_:

Click to download the PDB-style file with coordinates for d3kz7a_.
(The format of our PDB-style files is described here.)

Timeline for d3kz7a_: