Lineage for d3kz1f_ (3kz1 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867831Domain d3kz1f_: 3kz1 F: [179822]
    Other proteins in same PDB: d3kz1a1, d3kz1a2, d3kz1b1, d3kz1b2
    automated match to d1cxza_
    complexed with gsp, mg

Details for d3kz1f_

PDB Entry: 3kz1 (more details), 2.7 Å

PDB Description: Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated RhoA
PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d3kz1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kz1f_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOPe Domain Coordinates for d3kz1f_:

Click to download the PDB-style file with coordinates for d3kz1f_.
(The format of our PDB-style files is described here.)

Timeline for d3kz1f_: