SCOPe 2.07: Domain d3kz1e_: 3kz1 E:

Lineage for d3kz1e_ (3kz1 E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (36 PDB entries)
   Uniprot P61586 2-181

8. Domain d3kz1e_: 3kz1 E: [179821]
   Other proteins in same PDB: d3kz1a1, d3kz1a2, d3kz1b1, d3kz1b2
   automated match to d1cxza_
   complexed with gsp, mg

Details for d3kz1e_

PDB Entry: 3kz1, 2.7 Å

PDB Description: Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated RhoA

PDB Compounds: (E:) transforming protein rhoa

SCOPe Domain Sequences for d3kz1e_:

Sequence; same for both SEQRES and ATOM records:

>d3kz1e_ c.37.1.8 (E:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

Timeline for d3kz1e_:

• d3kz1e_ first appeared in SCOPe 2.01
  
• d3kz1e_ appears in SCOPe 2.06
  
• d3kz1e_ appears in the current release, SCOPe 2.08