Lineage for d9icwa1 (9icw A:9-91)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272498Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1272499Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1272500Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 1272501Species Human (Homo sapiens) [TaxId:9606] [47805] (132 PDB entries)
    Uniprot P06746
  8. 1272541Domain d9icwa1: 9icw A:9-91 [17982]
    Other proteins in same PDB: d9icwa3, d9icwa4
    protein/DNA complex; complexed with na, so4

Details for d9icwa1

PDB Entry: 9icw (more details), 2.6 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; native structure
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d9icwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icwa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOPe Domain Coordinates for d9icwa1:

Click to download the PDB-style file with coordinates for d9icwa1.
(The format of our PDB-style files is described here.)

Timeline for d9icwa1: