Lineage for d3kyya_ (3kyy A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066161Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1066170Protein Rubredoxin [57804] (8 species)
  7. 1066230Species Pyrococcus furiosus [TaxId:2261] [57809] (20 PDB entries)
    Uniprot P24297
  8. 1066243Domain d3kyya_: 3kyy A: [179818]
    automated match to d1bq8a_
    complexed with dod, fe

Details for d3kyya_

PDB Entry: 3kyy (more details), 1.1 Å

PDB Description: Joint Xray/neutron crystal structure determination of H-labeled perdeuterated rubredoxin at 295K
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d3kyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kyya_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d3kyya_:

Click to download the PDB-style file with coordinates for d3kyya_.
(The format of our PDB-style files is described here.)

Timeline for d3kyya_: