| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries) Uniprot Q93068 |
| Domain d3kycd_: 3kyc D: [179806] automated match to d1a5ra_ complexed with jzu, zn |
PDB Entry: 3kyc (more details), 2.45 Å
SCOPe Domain Sequences for d3kycd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kycd_ d.15.1.1 (D:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
geyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
elgmeeedvievyqeqcgg
Timeline for d3kycd_: