Lineage for d3ky2a_ (3ky2 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672896Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1672897Species Human (Homo sapiens) [TaxId:9606] [56159] (20 PDB entries)
  8. 1672922Domain d3ky2a_: 3ky2 A: [179803]
    automated match to d1agwb_
    complexed with so4

Details for d3ky2a_

PDB Entry: 3ky2 (more details), 2.7 Å

PDB Description: crystal structure of fibroblast growth factor receptor 1 kinase domain
PDB Compounds: (A:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3ky2a_:

Sequence, based on SEQRES records: (download)

>d3ky2a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
hmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
rivaltsnq

Sequence, based on observed residues (ATOM records): (download)

>d3ky2a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
hmagvseyelpedprwelprdrlvlgkplgeggqvvlaeaigldkdkpnrvtkvavkmlk
sdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarr
ppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvm
kiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlg
gspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldri
valtsnq

SCOPe Domain Coordinates for d3ky2a_:

Click to download the PDB-style file with coordinates for d3ky2a_.
(The format of our PDB-style files is described here.)

Timeline for d3ky2a_: