Lineage for d3kxsf_ (3kxs F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716878Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2716879Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2716880Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2716887Protein automated matches [191131] (3 species)
    not a true protein
  7. 2716893Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (4 PDB entries)
  8. 2716899Domain d3kxsf_: 3kxs F: [179801]
    automated match to d1qgtb_
    mutant

Details for d3kxsf_

PDB Entry: 3kxs (more details), 2.25 Å

PDB Description: crystal structure of hbv capsid mutant dimer (oxy form), strain adyw
PDB Compounds: (F:) capsid protein

SCOPe Domain Sequences for d3kxsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kxsf_ a.62.1.1 (F:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

SCOPe Domain Coordinates for d3kxsf_:

Click to download the PDB-style file with coordinates for d3kxsf_.
(The format of our PDB-style files is described here.)

Timeline for d3kxsf_: