Lineage for d1bpya1 (1bpy A:10-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2715908Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 2715909Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries)
    Uniprot P06746
  8. 2715979Domain d1bpya1: 1bpy A:10-91 [17980]
    Other proteins in same PDB: d1bpya3, d1bpya4
    protein/DNA complex; complexed with dct, mg, na

Details for d1bpya1

PDB Entry: 1bpy (more details), 2.2 Å

PDB Description: human dna polymerase beta complexed with gapped dna and ddctp
PDB Compounds: (A:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1bpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpya1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOPe Domain Coordinates for d1bpya1:

Click to download the PDB-style file with coordinates for d1bpya1.
(The format of our PDB-style files is described here.)

Timeline for d1bpya1: