SCOPe 2.06: Domain d3kxsc_: 3kxs C:

Lineage for d3kxsc_ (3kxs C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein automated matches [191131] (3 species)
   not a true protein

7. Species Hepatitis b virus [TaxId:10419] [189224] (1 PDB entry)

8. Domain d3kxsc_: 3kxs C: [179798]
   automated match to d1qgtb_
   mutant

Details for d3kxsc_

PDB Entry: 3kxs, 2.25 Å

PDB Description: crystal structure of hbv capsid mutant dimer (oxy form), strain adyw

PDB Compounds: (C:) capsid protein

SCOPe Domain Sequences for d3kxsc_:

Sequence; same for both SEQRES and ATOM records:

>d3kxsc_ a.62.1.1 (C:) automated matches {Hepatitis b virus [TaxId: 10419]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

Timeline for d3kxsc_:

• d3kxsc_ first appeared in SCOPe 2.01
  
• d3kxsc_ appears in SCOPe 2.05
  
• d3kxsc_ appears in SCOPe 2.07
  
• d3kxsc_ appears in the current release, SCOPe 2.08