| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) ![]() automatically mapped to Pfam PF00906 |
| Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
| Protein automated matches [191131] (3 species) not a true protein |
| Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (4 PDB entries) |
| Domain d3kxsb_: 3kxs B: [179797] automated match to d1qgtb_ mutant |
PDB Entry: 3kxs (more details), 2.25 Å
SCOPe Domain Sequences for d3kxsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kxsb_ a.62.1.1 (B:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst
Timeline for d3kxsb_: