SCOPe 2.06: Domain d3kxha_: 3kxh A:

Lineage for d3kxha_ (3kxh A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)

8. Domain d3kxha_: 3kxh A: [179793]
   automated match to d1dawa_
   complexed with k66, peg

Details for d3kxha_

PDB Entry: 3kxh, 1.7 Å

PDB Description: crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor (2-dymethylammino-4,5,6,7-tetrabromobenzoimidazol-1yl- acetic acid (k66)

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3kxha_:

Sequence; same for both SEQRES and ATOM records:

>d3kxha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

Timeline for d3kxha_:

• d3kxha_ first appeared in SCOPe 2.01
  
• d3kxha_ appears in SCOPe 2.05
  
• d3kxha_ appears in SCOPe 2.07
  
• d3kxha_ appears in the current release, SCOPe 2.08