Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (21 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [189565] (1 PDB entry) |
Domain d3kx9t_: 3kx9 T: [179787] automated match to d1s3qa1 complexed with gol |
PDB Entry: 3kx9 (more details), 2.1 Å
SCOPe Domain Sequences for d3kx9t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kx9t_ a.25.1.1 (T:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
Timeline for d3kx9t_: