Lineage for d1qckb_ (1qck B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001474Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
    contains one classic and one pseudo HhH motifs
    automatically mapped to Pfam PF02961
  5. 2001475Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)
  6. 2001476Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 2001477Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries)
  8. 2001486Domain d1qckb_: 1qck B: [17977]

Details for d1qckb_

PDB Entry: 1qck (more details)

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure plus 20 individual simulated annealing structures
PDB Compounds: (B:) protein (barrier-to-autointegration factor)

SCOPe Domain Sequences for d1qckb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qckb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

SCOPe Domain Coordinates for d1qckb_:

Click to download the PDB-style file with coordinates for d1qckb_.
(The format of our PDB-style files is described here.)

Timeline for d1qckb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qcka_