| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) ![]() contains one classic and one pseudo HhH motifs automatically mapped to Pfam PF02961 |
| Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins) |
| Protein Barrier-to-autointegration factor, BAF [47800] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47801] (23 PDB entries) |
| Domain d1qcka_: 1qck A: [17976] |
PDB Entry: 1qck (more details)
SCOPe Domain Sequences for d1qcka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcka_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl
Timeline for d1qcka_: