![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [189193] (1 PDB entry) |
![]() | Domain d3kwoc_: 3kwo C: [179757] Other proteins in same PDB: d3kwoa2, d3kwod2 automated match to d1ji4a_ complexed with acy, bu1, gol, zn |
PDB Entry: 3kwo (more details), 1.99 Å
SCOPe Domain Sequences for d3kwoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwoc_ a.25.1.0 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]} msvtkqllqmqadahhlwvkfhnyhwnvkglqffsiheytekayeemaelfdscaervlq lgekaitcqkvlmenakspkvakdcftplevielikqdyeyllaefkklneaaekesdtt taafaqeniakyekslwmigatlqgac
Timeline for d3kwoc_: