SCOP 1.59: Domain d2ezzb_: 2ezz B:

Lineage for d2ezzb_ (2ezz B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.60: SAM domain-like [47768] (11 superfamilies)

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (5 PDB entries)

8. Domain d2ezzb_: 2ezz B: [17975]

Details for d2ezzb_

PDB Entry: 2ezz

PDB Description: solution structure of human barrier-to-autointegration factor baf nmr, ensemble of 20 simulated annealing structures

SCOP Domain Sequences for d2ezzb_:

Sequence; same for both SEQRES and ATOM records:

>d2ezzb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens)}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d2ezzb_:

• d2ezzb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ezzb_ appears in SCOP 1.57
  
• d2ezzb_ appears in SCOP 1.61
  
• d2ezzb_ appears in the current release, SCOPe 2.08