Lineage for d3kv2b_ (3kv2 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1850946Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 1850967Protein Arginase [52770] (5 species)
  7. 1850999Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
    Uniprot P05089 5-313
  8. 1851009Domain d3kv2b_: 3kv2 B: [179734]
    automated match to d1wvaa1
    complexed with mn, nnh

Details for d3kv2b_

PDB Entry: 3kv2 (more details), 1.55 Å

PDB Description: high resolution structure of human arginase i in complex with the strong inhibitor n(omega)-hydroxy-nor-l-arginine (nor-noha)
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d3kv2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kv2b_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyl

SCOPe Domain Coordinates for d3kv2b_:

Click to download the PDB-style file with coordinates for d3kv2b_.
(The format of our PDB-style files is described here.)

Timeline for d3kv2b_: