Lineage for d3kv1a_ (3kv1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2151346Species Vibrio fischeri [TaxId:312309] [189167] (1 PDB entry)
  8. 2151347Domain d3kv1a_: 3kv1 A: [179732]
    automated match to d3efba1
    complexed with gol

Details for d3kv1a_

PDB Entry: 3kv1 (more details), 1.7 Å

PDB Description: Crystal Structure of Putative Sugar-Binding Domain of Transcriptional Repressor from Vibrio fischeri
PDB Compounds: (A:) Transcriptional Repressor

SCOPe Domain Sequences for d3kv1a_:

Sequence, based on SEQRES records: (download)

>d3kv1a_ c.124.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
svqleqklvekfnlkralisldqpntneqrkqvaalvssylnnnlqegmavavgqgqnva
avadhagivtqrnarfvsaiggthrsgdiinadhicrrlakkyggssetlyapayvndps
lrsafmehatiketlsqarkaefalvgigdmdenshmvklgfftpkefvearlndgivgd
iggfdffkldgtdadtlmrgrviglemedlrqipnvvamasesrkalsimgalrtgvidv
latsvscamallnlaen

Sequence, based on observed residues (ATOM records): (download)

>d3kv1a_ c.124.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
svqleqklvekfnlkralisldqpntneqrkqvaalvssylnnnlqegmavavgqgqnva
avadhagivtqrnarfvsaiggthiinadhicrrlakkyggssetlyapayvndpslrsa
fmehatiketlsqarkaefalvgigdmdenshmvklgfftpkefvearlndgivgdiggf
dffkldgtdadtlmrgrviglemedlrqipnvvamasesrkalsimgalrtgvidvlats
vscamallnlaen

SCOPe Domain Coordinates for d3kv1a_:

Click to download the PDB-style file with coordinates for d3kv1a_.
(The format of our PDB-style files is described here.)

Timeline for d3kv1a_: