SCOP 1.57: Domain d2ezyb_: 2ezy B:

Lineage for d2ezyb_ (2ezy B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.60: SAM domain-like [47768] (10 superfamilies)

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (5 PDB entries)

8. Domain d2ezyb_: 2ezy B: [17973]

Details for d2ezyb_

PDB Entry: 2ezy

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures

SCOP Domain Sequences for d2ezyb_:

Sequence; same for both SEQRES and ATOM records:

>d2ezyb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens)}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d2ezyb_:

• d2ezyb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ezyb_ appears in SCOP 1.59
  
• d2ezyb_ appears in the current release, SCOPe 2.08