Lineage for d2ezyb_ (2ezy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715850Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
    contains one classic and one pseudo HhH motifs
    automatically mapped to Pfam PF02961
  5. 2715851Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)
  6. 2715852Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 2715853Species Human (Homo sapiens) [TaxId:9606] [47801] (24 PDB entries)
  8. 2715895Domain d2ezyb_: 2ezy B: [17973]

Details for d2ezyb_

PDB Entry: 2ezy (more details)

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures
PDB Compounds: (B:) barrier-to-autointegration factor

SCOPe Domain Sequences for d2ezyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezyb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

SCOPe Domain Coordinates for d2ezyb_:

Click to download the PDB-style file with coordinates for d2ezyb_.
(The format of our PDB-style files is described here.)

Timeline for d2ezyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezya_