![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) ![]() contains one classic and one pseudo HhH motifs automatically mapped to Pfam PF02961 |
![]() | Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins) |
![]() | Protein Barrier-to-autointegration factor, BAF [47800] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47801] (24 PDB entries) |
![]() | Domain d2ezyb_: 2ezy B: [17973] |
PDB Entry: 2ezy (more details)
SCOPe Domain Sequences for d2ezyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezyb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]} mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr ewlkdtcganakqsrdcfgclrewcdafl
Timeline for d2ezyb_: