Lineage for d3kuud_ (3kuu D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439847Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2439848Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 protein domains)
    automatically mapped to Pfam PF00731
  6. 2439898Protein automated matches [191111] (3 species)
    not a true protein
  7. 2439953Species Yersinia pestis [TaxId:632] [189166] (1 PDB entry)
  8. 2439957Domain d3kuud_: 3kuu D: [179727]
    automated match to d1d7aa_
    complexed with so4

Details for d3kuud_

PDB Entry: 3kuu (more details), 1.41 Å

PDB Description: structure of the pure phosphoribosylaminoimidazole carboxylase catalytic subunit from yersinia pestis
PDB Compounds: (D:) Phosphoribosylaminoimidazole carboxylase catalytic subunit PurE

SCOPe Domain Sequences for d3kuud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kuud_ c.23.8.1 (D:) automated matches {Yersinia pestis [TaxId: 632]}
aagvkiaivmgsksdwatmqfaadvlttlnvpfhvevvsahrtpdrlfsfaeqaeanglh
viiagnggaahlpgmlaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigka
gaanaallaaqilalhdtelagrlahwrqsqtddvldnpdpreea

SCOPe Domain Coordinates for d3kuud_:

Click to download the PDB-style file with coordinates for d3kuud_.
(The format of our PDB-style files is described here.)

Timeline for d3kuud_: